# PDB Scan report for R1.pdb

## Structure contents summary


-------------------------------------------
Chain ID   Type       No.        Gaps      
                      Residues   Detected  
                      Found                
---------- ---------- ---------- ---------- 
A          Protein    90         Yes       
---------- ---------- ---------- ---------- 



### Heterogens 

None

###Biological Unit


No information detected

### Proposed segment to chain mapping

Segments rather than chains are used to create CHARMM 
parameterized structures. PDB Scan suggests the following 
mapping of residues from the input chains to segments.

--------------------------------------------------
Chain  Segname Type Resids        Indices         
------ ------- ---- ------------- ---------------- 
A      A       pro  9-98          1-664           
------ ------- ---- ------------- ---------------- 


### Proposed segment simulation readiness

Each proposed segment has been checked to see if it is ready for 
simulation through MD (in CHARMM) or SASSIE dihedral MC.

----------------------------------------
Segname    Single   CHARMM   MC     MD  
         Conformer                      
------- ----------- ------ ------ ------ 
   A         Y        Y      Y      N   
------- ----------- ------ ------ ------ 




WARNING: Segments A do not start with resid 1, check sequence is correct

## Sequence for chain A

### Sequence:


---------------------------------------------------------------
           `|123456789|123456789|123456789|123456789|123456789`
---------- ---------------------------------------------------- 
         0 `--------DGDPAKTPVTPDASRPATFVDANGQPVTGNTVPAMSNGQQVG`

        50 `TYELDPNTGQVTFKPNKTFVGTPDPVAVQVSDTNGVPHRARYQPTVTK  `
---------- ---------------------------------------------------- 


### Gaps:


None


### Heterogens:



None Found



### Missing heavy atoms:


No missing heavy atoms detected in recognized residues


### Statistics:


-------------------------------------------------- ---------------------------------------------------------------------------------------------------- 
Formula                                            C<sub>409</sub>O<sub>137</sub>N<sub>117</sub>S<sub>1</sub>                                          

Molecular weight                                   8775 Da : 8.78 kDa                                                                                  

Center of mass (x,y,z)                             (0.23, -0.79, 0.89) Angstrom                                                                        

Coordinate range (x,y,z)                           Low: (-19.30, -16.13, -11.84), High: (22.73, 14.47, 14.53) Angstrom                                 

Radius of gyration                                 13.44 Angstrom                                                                                      

Distance between N- & C-terminals                  20.53 Angstrom                                                                                      
-------------------------------------------------- ---------------------------------------------------------------------------------------------------- 


