| Chain ID | Type | No. Residues Found | Gaps Detected |
|---|---|---|---|
| A | Protein | 90 | Yes |
None
No information detected
Segments rather than chains are used to create CHARMM parameterized structures. PDB Scan suggests the following mapping of residues from the input chains to segments.
| Chain | Segname | Type | Resids | Indices |
|---|---|---|---|---|
| A | A | pro | 9-98 | 1-664 |
Each proposed segment has been checked to see if it is ready for simulation through MD (in CHARMM) or SASSIE dihedral MC.
| Segname | Single Conformer | CHARMM | MC | MD |
|---|---|---|---|---|
| A | Y | Y | Y | N |
WARNING: Segments A do not start with resid 1, check sequence is correct
|123456789|123456789|123456789|123456789|123456789 |
|
|---|---|
| 0 | --------DGDPAKTPVTPDASRPATFVDANGQPVTGNTVPAMSNGQQVG |
| 50 | TYELDPNTGQVTFKPNKTFVGTPDPVAVQVSDTNGVPHRARYQPTVTK |
None
None Found
No missing heavy atoms detected in recognized residues
| Formula | C409O137N117S1 |
| Molecular weight | 8775 Da : 8.78 kDa |
| Center of mass (x,y,z) | (0.23, -0.79, 0.89) Angstrom |
| Coordinate range (x,y,z) | Low: (-19.30, -16.13, -11.84), High: (22.73, 14.47, 14.53) Angstrom |
| Radius of gyration | 13.44 Angstrom |
| Distance between N- & C-terminals | 20.53 Angstrom |